PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta012021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family LBD
Protein Properties Length: 172aa    MW: 19208 Da    PI: 9.5573
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-24088PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260121.45e-38181171100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrr+Ca++ ++apyf   +p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA+ar+rdPvyG++g+i +lq+q + l++el+++k+e
  Pta012021  18 PCAACKLLRRRCAQERPFAPYFSPLEPQKFASVHKVFGASNVSKMLMEVPENQRADAANSLVYEANARLRDPVYGSTGTIYSLQHQAQVLRVELNAMKAE 117
                7**********************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.71617118IPR004883Lateral organ boundaries, LOB
PfamPF031958.2E-3818115IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MTHRPTVGSP AALNTITPCA ACKLLRRRCA QERPFAPYFS PLEPQKFASV HKVFGASNVS  60
KMLMEVPENQ RADAANSLVY EANARLRDPV YGSTGTIYSL QHQAQVLRVE LNAMKAEILK  120
YKCRDPMSQP PMLGVYNVNS DDCKVNNPTG STVNAADYTV KQRYYSIINH NR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.153721e-179root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007011230.14e-67LOB domain-containing protein 15
RefseqXP_012448054.14e-67PREDICTED: LOB domain-containing protein 15
SwissprotQ8L5T51e-59LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A061FRT35e-67A0A061FRT3_THECC; LOB domain-containing protein 15
TrEMBLA0A0D2QQ345e-67A0A0D2QQ34_G
STRINGVIT_13s0067g02380.t017e-65(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.17e-61LOB domain-containing protein 15